| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
+31 | 87-130 | 44 | 1-86, 131-219 | 86 | 89 | knot |
Chain Sequence |
SMIFNVLTIFPQMFPGPLGVSNLGSALKKGLWTLNVFDIRAFANNKHNTVDDTPYGGGPGMLLRADVLGRCIDEVLSLHPNTKLMFTSPRGVSFTQDIARQTMNFDNITLLCGRFEGIDERVVDFYKLQEVSIGDYVLSGGELAAMVIIDTCVRMVPGVIGNAESLKQESMEGSLEYPQYTRPASWKGMEVPEVLLTGNHGEIEKWRRNASLSITAARR
|
Knotoid cutoff: 0.5
Knotoid matrix content: 1
| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
3.1 | 86-132 | 47 | 1-85, 133-219 | 85 | 87 | knot | ||||
| view details |
 |
2.1 | 87-134 | 48 | 1-85, 170-219 | 86-86, 135-169 | 85 | 50 | slipknot |
| sequence length |
219
|
| structure length |
219
|
| publication title |
Structure of unliganded tRNA (guanine-N1)-methyltransferase found in Anaplasma phagocytophilum
rcsb |
| molecule tags |
Transferase
|
| molecule keywords |
tRNA (guanine-N(1)-)-methyltransferase
|
| source organism |
Anaplasma phagocytophilum
|
| total genus |
 Genus: 55
|
| ec nomenclature |
ec
2.1.1.228: Alcohol dehydrogenase. |
| pdb deposition date | 2019-09-23 |
| KnotProt deposition date | 2019-10-17 |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
