6V7KA

Crystal structure of vascular endothelial growth factor (vegf8-109) with one copy of hh4, an alpha/beta-peptide with irregular secondary structure
Cysteine knot
Loop Piercing
view details
57-c-61-b-104-c-102 26-b-68
Chain Sequence
EVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPK
sequence length 95
structure length 95
publication title High-Resolution Structure for a Complex Between One Copy of a Non-Helical Foldamer and VEGF
rcsb
molecule tags Protein binding
molecule keywords Vascular endothelial growth factor A
source organism Homo sapiens
ec nomenclature
pdb deposition date 2019-12-08
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling