| Loop | Piercing | ||||
|---|---|---|---|---|---|
| view details | 2-c-9-b-24-c-17 | 16-b-31 |
Chain Sequence |
ECLEIFKACNPSNDQCCKSSKLVCSRKTRWCKYQI
|
| sequence length |
35
|
| structure length |
35
|
| publication title |
NaChBac in GDN
rcsb |
| molecule tags |
Transport protein/toxin
|
| molecule keywords |
NaChBac-Nav1.7VSDII chimera
|
| source organism |
Bacillus halodurans (strain atcc baa-125 / dsm 18197 / ferm 7344 / jcm 9153 / c-125)
|
| ec nomenclature | |
| pdb deposition date | 2020-03-17 |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
