6W6OC

Nachbac-nav1.7vsdii chimera and hwtx-iv complex
Cysteine knot
Loop Piercing
view details
2-c-9-b-24-c-17 16-b-31
Chain Sequence
ECLEIFKACNPSNDQCCKSSKLVCSRKTRWCKYQI
sequence length 35
structure length 35
publication title NaChBac in GDN
rcsb
molecule tags Transport protein/toxin
molecule keywords NaChBac-Nav1.7VSDII chimera
source organism Bacillus halodurans (strain atcc baa-125 / dsm 18197 / ferm 7344 / jcm 9153 / c-125)
ec nomenclature
pdb deposition date 2020-03-17
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling
Application loaded.