6XHEA

Structure of beta-prolinyl 5'-o-adenosine phosphoramidate
Cysteine knot
Loop Piercing
view details
40-c-58-b-110-c-95 26-b-84
Chain Sequence
KETAAAKFERQHMDSSTSAASSSNYCNQMMKSRNLTKDRCKPVNTFVHESLADVQAVCSQKNVACKNGQTNCYQSYSTMSITDCRETGSSKYPNCAYKTTQANKHIIVACEGNPYVPVHFDASV
sequence length 124
structure length 124
publication title The Enzyme-Free Release of Nucleotides from Phosphoramidates Depends Strongly on the Amino Acid.
pubmed doi rcsb
molecule tags Rna binding protein
molecule keywords Ribonuclease pancreatic
source organism Bos taurus
ec nomenclature ec 4.6.1.18: Pancreatic ribonuclease.
pdb deposition date 2020-06-18
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling