| Loop | Piercing | ||||
|---|---|---|---|---|---|
| view details | 346-c-350-b-413-c-411 | 317-b-380 |
Chain Sequence |
ALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS
|
| sequence length |
112
|
| structure length |
112
|
| publication title |
TGFb2 and TGFb3 isoforms drive fibrotic disease pathogenesis
rcsb |
| molecule tags |
Cytokine/immune system
|
| molecule keywords |
4A11.v7 kappa light chain Fab (VL-CL) humanized
|
| source organism |
Homo sapiens
|
| ec nomenclature | |
| pdb deposition date | 2020-06-29 |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
