6XM2I

The structure of the 4a11.v7 antibody in complex with human tgfb2
Cysteine knot
Loop Piercing
view details
346-c-350-b-413-c-411 317-b-380
Chain Sequence
ALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS
sequence length 112
structure length 112
publication title TGFb2 and TGFb3 isoforms drive fibrotic disease pathogenesis
rcsb
molecule tags Cytokine/immune system
molecule keywords 4A11.v7 kappa light chain Fab (VL-CL) humanized
source organism Homo sapiens
ec nomenclature
pdb deposition date 2020-06-29
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling
Application loaded.