6XUOA

Mature recombinant horse ngf
Cysteine knot
Loop Piercing
view details
58-c-68-b-110-c-108 15-b-80
Chain Sequence
GEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKT
sequence length 107
structure length 107
publication title Mature horse nerve growth factor at 2.8 angstrom resolution
rcsb
molecule tags Cytokine
molecule keywords Nerve growth factor
source organism Equus caballus
ec nomenclature
pdb deposition date 2020-01-20
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling