6XYIA

Nmr solution structure of alpha-anmtx- ms11a-3 (ms11a-3)
Cysteine knot
Loop Piercing
view details
2-c-9-b-22-c-17 16-b-37
Chain Sequence
GCKKLNSYCTRQHRECCHGLVCRRPDYGIGRGILWKCTRARK
sequence length 42
structure length 42
publication title NMR solution structure of alpha-AnmTX- Ms11a-3 (Ms11a-3)
rcsb
molecule tags Toxin
molecule keywords AMS9.3.1
source organism Metridium senile
ec nomenclature
pdb deposition date 2020-01-30
Image from the rcsb pdb (www.rcsb.org)
6XYHA
similar chains in the KnotProt database (40% sequence similarity)
None
similar chains in the pdb database (40% sequence similarity)

 
#similar chains in the KnotProt database (40% sequence similarity)
6XYH A; 
#similar chains, but unknotted

#similar chains in the pdb database (40% sequence similarity)


KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling
Application loaded.