6YBCA

Rnase 3/1 version2 phosphate complex
Cysteine knot
Loop Piercing
view details
43-c-61-b-113-c-98 29-b-87
Chain Sequence
MRPPQFTRAQWFAIQHIDSDSSPSSSSRYCTIAMRAINNYRWRCKPVNTFVHEPLVDVQNVCFQEKVTCKNGQGNCYRSRFRMHITDCRLTNGSRYPNCRYRTRPGRRHIIVACENRDPRDSPRYPYVPVHFDA
sequence length 134
structure length 134
publication title Structural and functional characterization of new family enzymes derivates from human RNase 1 and 3 with antimicrobial and ribonuclease activity
rcsb
molecule tags Hydrolase
molecule keywords RNASE 3/1 version2
source organism Synthetic construct
ec nomenclature
pdb deposition date 2020-03-16
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling
Application loaded.