| Loop | Piercing | ||||
|---|---|---|---|---|---|
| view details | 43-c-61-b-113-c-98 | 29-b-87 |
Chain Sequence |
MRPPQFTRAQWFAIQHIDSDSSPSSSSRYCTIAMRAINNYRWRCKPVNTFVHEPLVDVQNVCFQEKVTCKNGQGNCYRSRFRMHITDCRLTNGSRYPNCRYRTRPGRRHIIVACENRDPRDSPRYPYVPVHFDA
|
| sequence length |
134
|
| structure length |
134
|
| publication title |
Structural and functional characterization of new family enzymes derivates from human RNase 1 and 3 with antimicrobial and ribonuclease activity
rcsb |
| molecule tags |
Hydrolase
|
| molecule keywords |
RNASE 3/1 version2
|
| source organism |
Synthetic construct
|
| ec nomenclature | |
| pdb deposition date | 2020-03-16 |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
