Loop | Piercing | ||||
---|---|---|---|---|---|
view details | 43-c-61-b-113-c-98 | 29-b-87 |
Chain Sequence |
MRPPQFTRAQWFAIQHIDSDSSPSSSSRYCTIAMRAINNYRWRCKPVNTFVHEPLVDVQNVCFQEKVTCKNGQGNCYRSRFRMHITDCRLTNGSKYPNCRYRTRPGRRHIIVACEGSPYVPVHFDASV
|
sequence length |
128
|
structure length |
128
|
publication title |
Structural and functional characterization of new family enzymes derivates from human RNase 1 and 3 with antimicrobial and ribonuclease activity
rcsb |
molecule tags |
Hydrolase
|
molecule keywords |
RNase 3/1 version 1
|
source organism |
Synthetic construct
|
ec nomenclature | |
pdb deposition date | 2020-04-09 |
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...