| Loop | Piercing | ||||
|---|---|---|---|---|---|
| view details | 57-c-61-b-104-c-102 | 26-b-68 |
Chain Sequence |
EVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPK
|
| sequence length |
95
|
| structure length |
95
|
| publication title |
Structure and thermodynamics of VEGF-A ligands : bicyclic peptides stabilized by a lactam bridge.
rcsb |
| molecule tags |
Peptide binding protein
|
| molecule keywords |
bicyclic peptide 3C
|
| source organism |
Homo sapiens
|
| ec nomenclature | |
| pdb deposition date | 2020-05-12 |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
