6Z3LA

Repulsive guidance molecule c (rgmc, hemojuvelin, hjv, hfe2) in complex with growth differentiation factor 5 (gdf5)
Cysteine knot
Loop Piercing
view details
429-c-433-b-500-c-498 400-b-466
Chain Sequence
KARCSRKALHVNFKDMGWDDWIIAPLEYEAFHCEGLCEFPLRSHLEPTNHAVIQTLMNSMDPESTPPTCCVPTRLSPISILFIDSANNVVYKQYEDMVVESCGCR
sequence length 105
structure length 105
publication title Repulsive guidance molecules lock growth differentiation factor 5 in an inhibitory complex.
pubmed doi rcsb
molecule tags Signaling protein
molecule keywords Growth/differentiation factor 5
source organism Homo sapiens
ec nomenclature
pdb deposition date 2020-05-20
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling
Application loaded.