| Loop | Piercing | ||||
|---|---|---|---|---|---|
| view details | 429-c-433-b-500-c-498 | 400-b-466 |
Chain Sequence |
KARCSRKALHVNFKDMGWDDWIIAPLEYEAFHCEGLCEFPLRSHLEPTNHAVIQTLMNSMDPESTPPTCCVPTRLSPISILFIDSANNVVYKQYEDMVVESCGCR
|
| sequence length |
105
|
| structure length |
105
|
| publication title |
Repulsive guidance molecules lock growth differentiation factor 5 in an inhibitory complex.
pubmed doi rcsb |
| molecule tags |
Signaling protein
|
| molecule keywords |
Growth/differentiation factor 5
|
| source organism |
Homo sapiens
|
| ec nomenclature | |
| pdb deposition date | 2020-05-20 |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
