Loop | Piercing | ||||
---|---|---|---|---|---|
view details | 429-c-433-b-500-c-498 | 400-b-466 |
Chain Sequence |
KARCSRKALHVNFKDMGWDDWIIAPLEYEAFHCEGLCEFPLRSHLEPTNHAVIQTLMNSMDPESTPPTCCVPTRLSPISILFIDSANNVVYKQYEDMVVESCGCR
|
sequence length |
105
|
structure length |
105
|
publication title |
Repulsive guidance molecules lock growth differentiation factor 5 in an inhibitory complex.
pubmed doi rcsb |
molecule tags |
Signaling protein
|
molecule keywords |
Growth/differentiation factor 5
|
source organism |
Homo sapiens
|
ec nomenclature | |
pdb deposition date | 2020-05-21 |
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...