6ZBRV

Vegf-a 13:107 crystallized with 4c bicyclic peptide
Cysteine knot
Loop Piercing
view details
57-c-61-b-104-c-102 26-b-68
Chain Sequence
EVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPK
sequence length 95
structure length 95
publication title Structure and thermodynamics of VEGF-A ligands: bicyclic peptides stabilized by a lactam bridge.
rcsb
molecule tags Peptide binding protein
molecule keywords Chains: P
source organism Homo sapiens
ec nomenclature
pdb deposition date 2020-06-09
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling
Application loaded.