| Loop | Piercing | ||||
|---|---|---|---|---|---|
| view details | 103-c-121-b-151-c-128 | 103-b-121 |
Chain Sequence |
MLKCYTCKEPMTSASCRTITRCKPEDTACMTTLVTVEAEYPFNQSPVVTRSCSSSCVATDPDSIGAAHLIFCCFRDLCNSEL
|
| sequence length |
82
|
| structure length |
82
|
| publication title |
Structural Diversity and Dynamics of Human Three-Finger Proteins Acting on Nicotinic Acetylcholine Receptors.
pubmed doi rcsb |
| molecule tags |
Neuropeptide
|
| molecule keywords |
Secreted Ly-6/uPAR-related protein 1
|
| source organism |
Homo sapiens
|
| ec nomenclature | |
| pdb deposition date | 2020-08-04 |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
