| Loop | Piercing | ||||
|---|---|---|---|---|---|
| view details | 169-c-173-b-234-c-232 | 142-b-203 |
Chain Sequence |
QGRGCLLKEIHLNVTDLDLGYRTKEELIFRYCSGPCHDAETNYDKILNNLTHNKKLDKDTPSRTCCRPIAFDDDISFLDDSLEYHTLKKHSAKKCACV
|
| sequence length |
98
|
| structure length |
98
|
| publication title |
A two-site flexible clamp mechanism for RET-GDNF-GFRa1 assembly reveals both conformational adaptation and strict geometric spacing
doi rcsb |
| molecule tags |
Signaling protein
|
| molecule keywords |
GDNF family receptor alpha
|
| source organism |
Danio rerio
|
| ec nomenclature | |
| pdb deposition date | 2020-09-07 |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
