7AMLC

Ret/gdnf/gfra1 extracellular complex cryo-em structure
Warning
  • Chain breaks within knotoid 31 (displayed as a gray area on the plot and as '-' on the sequence). The broken part of the chain has been replaced by a straight segment, which may affect what knot types are detected - be careful with interpreting results.
Cysteine knot
Loop Piercing
view details
169-c-173-b-234-c-232 142-b-203
Chain Sequence
QGRGCLLKEIHLNVTDLDLGYRTKEELIFRYCSGPCHDAETNYDKILNNLTHNKKLDKDTPSRTCCRPIAFDDDISFLDDSLEYHTLKKHSAKKCACV
sequence length 98
structure length 98
publication title A two-site flexible clamp mechanism for RET-GDNF-GFR alpha 1 assembly reveals both conformational adaptation and strict geometric spacing.
pubmed doi rcsb
molecule tags Signaling protein
molecule keywords Proto-oncogene tyrosine-protein kinase receptor Ret
source organism Danio rerio
ec nomenclature
pdb deposition date 2020-10-09
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling
Application loaded.