| Loop | Piercing | ||||
|---|---|---|---|---|---|
| view details | 27-c-27-b-44-c-41 | 24-b-41 |
Chain Sequence |
TMIYLCADCGARNTIQAKEVIRCRECGHRVMYKMRTKRMVQFEAR
|
| sequence length |
45
|
| structure length |
45
|
| publication title |
Conserved strategies of RNA polymerase I hibernation and activation.
pubmed doi rcsb |
| molecule tags |
Transcription
|
| molecule keywords |
DNA-directed RNA polymerase I subunit rpa1
|
| ec nomenclature | |
| pdb deposition date | 2020-10-14 |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...