Loop | Piercing | ||||
---|---|---|---|---|---|
view details | 47-c-56-b-97-c-95 | 10-b-65 |
Chain Sequence |
PFLCESEQLLIHPKEELSRNNSMVWIVNTKDYKQGVRIEKCLKRQLGKPCNFCDADTECKQLFHYRTLVAVDKVTKKPYKEQVLLPSCCKCAKILS
|
sequence length |
96
|
structure length |
96
|
publication title |
Structure and dynamics of Toll immunoreceptor activation in the mosquito Aedes aegypti.
pubmed doi rcsb |
molecule tags |
Immune system
|
molecule keywords |
Toll-like receptor
|
source organism |
Aedes aegypti
|
ec nomenclature | |
pdb deposition date | 2020-11-24 |
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...