7BFKA

X-ray structure of ss-rnase-2
Cysteine knot
Loop Piercing
view details
39-c-57-b-106-c-91 23-b-80
Chain Sequence
MDVNQQYNHFLKQHVDGEMTTLKCKSQMEILNLNRPDRKCKLKNTFILANPDQVQAICTGGGTLKGNNLVQSNKPFSVVICTHTGGESHPNCTYKGSSATKKVIIACDGKFPVHYDGDVDIGITD
sequence length 125
structure length 125
publication title The structural features of an ancient ribonuclease from Salmo salar reveal an intriguing case of auto-inhibition.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Angiogenin-1
source organism Salmo salar
ec nomenclature
pdb deposition date 2021-01-04
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling