7BFLA

X-ray structure of ss-rnase-2 des116-120
Cysteine knot
Loop Piercing
view details
39-c-57-b-106-c-91 23-b-80
Chain Sequence
DVNQQYNHFLKQHVDGEMTTLKCKSQMEILNLNC-----KLKNTFILANPDQVQAICTGGGTLKGNNLVQSNKPFSVVICTHTGGESHPNCTYKGSSATKKVIIACDGKFPVHYDGITD
sequence length 119
structure length 114
publication title The structural features of an ancient ribonuclease from Salmo salar reveal an intriguing case of auto-inhibition.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Angiogenin-1
source organism Salmo salar
missing residues 34-38
ec nomenclature
pdb deposition date 2021-01-04
Image from the rcsb pdb (www.rcsb.org)
2VQ9A 3LJEA 7BFKA
similar chains in the KnotProt database (40% sequence similarity)
None
similar chains in the pdb database (40% sequence similarity)

 
#similar chains in the KnotProt database (40% sequence similarity)
2VQ9 A; 3LJE A; 7BFK A; 
#similar chains, but unknotted

#similar chains in the pdb database (40% sequence similarity)


KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling
Application loaded.