
Jmol._Canvas2D (Jmol) "jmolApplet0"[x]
Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
---|---|---|---|---|---|---|---|---|---|---|---|---|
view details |
![]() |
+31 | 80-122 | 43 | 1-79, 123-159 | 79 | 37 | knot |
Chain Sequence |
MFDIALYEPEIAPNTGNIIRLCANCGANLHLIEPLGFDLEEKKVRRAGLDYHDLARVTRHKNYQAFLDYLEQRGEYRIFACTTKTTGHHVDAQYRQGDVLLFGPETRGLPMEVIESLPMSQRIRIPMMPDARSLNLSNAVAIIAFEAWRQLGFQGAKGH
|
Knotoid cutoff: 0.5
Knotoid matrix content: 1
Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
---|---|---|---|---|---|---|---|---|---|---|---|---|
view details |
![]() |
2.1 | 79-123 | 45 | 1-78 | 140-159 | 124-139 | 78 | 20 | slipknot | ||
view details |
![]() |
2.1 | 79-139 | 61 | 140-159 | 1-3 | 4-78 | 3 | 19 | slipknot |
sequence length |
159
|
structure length |
159
|
publication title |
Crystal structure of SAH bound TrmL from Vibrio vulnificus
rcsb |
molecule tags |
Transferase
|
molecule keywords |
tRNA (cytidine(34)-2'-O)-methyltransferase
|
source organism |
Vibrio vulnificus
|
ec nomenclature |
ec
2.1.1.207: tRNA (cytidine(34)-2'-O)-methyltransferase. |
pdb deposition date | 2021-02-09 |
KnotProt deposition date | 2022-05-11 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF00588 | SpoU_methylase | SpoU rRNA Methylase family |
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...