7FIGX

Luteinizing hormone/choriogonadotropin receptor(s277i)-chorionic gonadotropin-gs complex
Cysteine knot
Loop Piercing
view details
28-c-32-b-84-c-82 10-b-60
Chain Sequence
QDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS
sequence length 88
structure length 88
publication title Structures of full-length glycoprotein hormone receptor signalling complexes
doi rcsb
molecule tags Membrane protein
molecule keywords Engineered guanine nucleotide-binding protein G(s) subunit alpha
source organism Bos taurus
ec nomenclature
pdb deposition date 2021-07-31
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling
Application loaded.