Loop | Piercing | ||||
---|---|---|---|---|---|
view details | 9-c-23-b-72-c-57 | 34-b-88 |
Chain Sequence |
KEPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCD
|
sequence length |
110
|
structure length |
110
|
publication title |
Structures of full-length glycoprotein hormone receptor signalling complexes
doi rcsb |
molecule tags |
Membrane protein
|
molecule keywords |
Engineered guanine nucleotide-binding protein G(s) subunit alpha
|
source organism |
Bos taurus
|
ec nomenclature | |
pdb deposition date | 2021-07-31 |
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...