| Loop | Piercing | ||||
|---|---|---|---|---|---|
| view details | 9-c-23-b-72-c-57 | 34-b-88 |
Chain Sequence |
KEPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCD
|
| sequence length |
110
|
| structure length |
110
|
| publication title |
Structures of full-length glycoprotein hormone receptor signalling complexes
doi rcsb |
| molecule tags |
Membrane protein
|
| molecule keywords |
Engineered Guanine nucleotide-binding protein G(s) subunit alpha
|
| source organism |
Bos taurus
|
| ec nomenclature | |
| pdb deposition date | 2021-07-31 |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
