| Loop | Piercing | ||||
|---|---|---|---|---|---|
| view details | 3-c-15-b-36-c-32 | 20-b-45 |
Chain Sequence |
AHCDHFLGEAPVYPCKEKACKSVCKEHYHHACKGECEYHGREVHCHCYGDYH
|
| sequence length |
52
|
| structure length |
52
|
| publication title |
Histidine-Rich Defensins from theSolanaceaeandBrasicaceaeAre Antifungal and Metal Binding Proteins.
pubmed doi rcsb |
| molecule tags |
Antifungal protein
|
| molecule keywords |
Defensin-like protein 204
|
| source organism |
Arabidopsis thaliana
|
| ec nomenclature | |
| pdb deposition date | 2020-08-03 |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
