7JPMA

The solution structure of omega-theraphotoxin-pm1b isolated from king baboon spider
Cysteine knot
Loop Piercing
view details
7-c-14-b-26-c-21 20-b-34
Chain Sequence
GVDKPGCRYLFGGCKSDDDCCPRLGCKGKGHDYCAWDGTFSD
sequence length 42
structure length 42
publication title Multimodal actions of a pain-sensitizing peptide from the King Baboon Spider Pelinobius muticus
rcsb
molecule tags Toxin
molecule keywords Omega-theraphotoxin-Pm1b
ec nomenclature
pdb deposition date 2020-08-09
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling