| Loop | Piercing | ||||
|---|---|---|---|---|---|
| view details | 2-c-9-b-24-c-17 | 16-b-31 |
Chain Sequence |
CLGIFKACNPSNDQCCKSSKLVCSRKTRWCKWQ
|
| sequence length |
33
|
| structure length |
33
|
| publication title |
Structural Basis for High-Affinity Trapping of the Na V 1.7 Channel in Its Resting State by Tarantula Toxin.
pubmed doi rcsb |
| molecule tags |
Membrane protein
|
| molecule keywords |
Maltose/maltodextrin-binding periplasmic protein,Ion transport protein,Sodium channel protein type 9 subunit alpha chimera
|
| source organism |
Escherichia coli (strain k12)
|
| ec nomenclature | |
| pdb deposition date | 2020-09-15 |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
