7K48E

Structure of navab/nav1.7-vs2a chimera trapped in the resting state by tarantula toxin m3-huwentoxin-iv
Cysteine knot
Loop Piercing
view details
2-c-9-b-24-c-17 16-b-31
Chain Sequence
CLGIFKACNPSNDQCCKSSKLVCSRKTRWCKWQ
sequence length 33
structure length 33
publication title Structural Basis for High-Affinity Trapping of the Na V 1.7 Channel in Its Resting State by Tarantula Toxin.
pubmed doi rcsb
molecule tags Membrane protein
molecule keywords Maltose/maltodextrin-binding periplasmic protein,Ion transport protein,Sodium channel protein type 9 subunit alpha chimera
source organism Escherichia coli (strain k12)
ec nomenclature
pdb deposition date 2020-09-15
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling