7L0JA

Structure of amh bound to amhr2-ecd
Cysteine knot
Loop Piercing
view details
488-c-492-b-559-c-557 462-b-526
Chain Sequence
DGPCALRELSVDLRAERSVLIPETYQANNCQGVCGWPQSDRNPRYGNHVVLLLKMQARGAALARPPCCVPTAYAGKLLISLSEERISAHHVPNMVATECGCR
sequence length 102
structure length 102
publication title Structure of AMH bound to AMHR2 provides insight into a unique signaling pair in the TGF-beta family
rcsb
molecule tags Signaling protein
molecule keywords Muellerian-inhibiting factor
source organism Homo sapiens
ec nomenclature
pdb deposition date 2020-12-11
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling
Application loaded.