| Loop | Piercing | ||||
|---|---|---|---|---|---|
| view details | 488-c-492-b-559-c-557 | 462-b-526 |
Chain Sequence |
DGPCALRELSVDLRAERSVLIPETYQANNCQGVCGWPQSDRNPRYGNHVVLLLKMQARGAALARPPCCVPTAYAGKLLISLSEERISAHHVPNMVATECGCR
|
| sequence length |
102
|
| structure length |
102
|
| publication title |
Structure of AMH bound to AMHR2 provides insight into a unique signaling pair in the TGF-beta family
rcsb |
| molecule tags |
Signaling protein
|
| molecule keywords |
Muellerian-inhibiting factor
|
| source organism |
Homo sapiens
|
| ec nomenclature | |
| pdb deposition date | 2020-12-11 |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
