7L2ME

Cryo-em structure of dktx/rtx-bound full-length trpv1
Cysteine knot
Loop Piercing
view details
2-c-9-b-23-c-16 15-b-31
Chain Sequence
DCAKEGEVCSWGKKCCDLDNFYCPMEFIPHCKKYKPYVPVTTNCAKEGEVCGWGSKCCHGLDCPLAFIPYCEKYR
sequence length 75
structure length 75
publication title Structural snapshots of TRPV1 reveal mechanism of polymodal functionality.
pubmed doi rcsb
molecule tags Transport protein
molecule keywords Transient receptor potential cation channel subfamily V member 1
source organism Rattus norvegicus
ec nomenclature
pdb deposition date 2020-12-17
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling