7L2R | KnotProt

7L2RE

Cryo-em structure of dktx-bound minimal trpv1 at the pre-open state

Image from the <span class='capital'>rcsb pdb</span> (www.rcsb.org)

Warning

Chain breaks within knotoid 3₁ (displayed as a gray area on the plot and as '-' on the sequence). The broken part of the chain has been replaced by a straight segment, which may affect what knot types are detected - be careful with interpreting results.

Cysteine knot

loadScript /static/js/j2s/core/package.js

loadScript /static/js/j2s/core/corejmol.z.js

loadScript /static/js/j2s/core/corescript.z.js

JSmol exec jmolApplet3 start applet null

Jmol JavaScript applet jmolApplet3__042209845744147__ initializing

Jmol getValue debug null

Jmol getValue logLevel null

Jmol getValue allowjavascript null

AppletRegistry.checkIn(jmolApplet3__042209845744147__)

vwrOptions:

{ "name":"jmolApplet3","applet":true,"documentBase":"https://knotprot.cent.uw.edu.pl/view/7l2r/E/","platform":"J.awtjs2d.Platform","fullName":"jmolApplet3__042209845744147__","codePath":"https:/static/js/j2s/","display":"jmolApplet3_canvas2d","signedApplet":"true","appletReadyCallback":"Jmol._readyCallback","statusListener":"[J.appletjs.Jmol object]","syncId":"042209845744147","bgcolor":"white" }

setting document base to "https://knotprot.cent.uw.edu.pl/view/7l2r/E/"

Jmol Version: 14.29.13 2018-04-17 17:17

java.vendor: Java2Script (HTML5)

java.version: 2018-01-28 23:38:52 (JSmol/j2s)

os.name: Mozilla/5.0 AppleWebKit/537.36 (KHTML, like Gecko; compatible; ClaudeBot/1.0; +claudebot@anthropic.com)

Access: ALL

memory: 0.0/0.0

processors available: 1

useCommandThread: false

appletId:jmolApplet3 (signed)

Jmol getValue emulate null

defaults = "Jmol"

Jmol getValue boxbgcolor null

Jmol getValue bgcolor white

backgroundColor = "white"

Jmol getValue ANIMFRAMECallback null

Jmol getValue APPLETREADYCallback Jmol._readyCallback

APPLETREADYCallback = "Jmol._readyCallback"

callback set for APPLETREADYCallback Jmol._readyCallback APPLETREADY

Jmol getValue ATOMMOVEDCallback null

Jmol getValue AUDIOCallback null

Jmol getValue CLICKCallback null

Jmol getValue DRAGDROPCallback null

Jmol getValue ECHOCallback null

Jmol getValue ERRORCallback null

Jmol getValue EVALCallback null

Jmol getValue HOVERCallback null

Jmol getValue IMAGECallback null

Jmol getValue LOADSTRUCTCallback null

Jmol getValue MEASURECallback null

Jmol getValue MESSAGECallback null

Jmol getValue MINIMIZATIONCallback null

Jmol getValue SERVICECallback null

Jmol getValue PICKCallback null

Jmol getValue RESIZECallback null

Jmol getValue SCRIPTCallback null

Jmol getValue SYNCCallback null

Jmol getValue STRUCTUREMODIFIEDCallback null

Jmol getValue doTranslate null

language=en_US

Jmol getValue popupMenu null

Jmol getValue script null

Jmol getValue loadInline null

Jmol getValue load null

Jmol applet jmolApplet3__042209845744147__ ready

script 1 started

platformSpeed = 8

Help Cysteine knot data interpretation Full screen

				Loop	Piercing
view details				2-c-9-b-23-c-16	15-b-31

Chain Sequence

DCAKEGEVCSWGKKCCDLDNFYCPMEFIPHCKKYKPYVPVTTNCAKEGEVCGWGSKCCHGLDCPLAFIPYCEKYR

sequence length	75
structure length	75
publication title	Structural snapshots of TRPV1 reveal mechanism of polymodal functionality. pubmed doi rcsb
molecule tags	Transport protein
molecule keywords	Transient receptor potential cation channel subfamily V member 1
source organism	Rattus norvegicus
ec nomenclature
pdb deposition date	2020-12-17

Image from the rcsb pdb (www.rcsb.org)

...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)

...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

How to cite

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling

Application loaded.