Loop | Piercing | ||||
---|---|---|---|---|---|
view details | 84-c-88-b-131-c-129 | 53-b-95 |
Chain Sequence |
EVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKD
|
sequence length |
97
|
structure length |
97
|
publication title |
A Non-immunogenic Bivalent D-Protein Potently Inhibits Retinal Vascularization and Tumor Growth
rcsb |
molecule tags |
Biosynthetic protein
|
molecule keywords |
Isoform L-VEGF189 of Vascular endothelial growth factor A
|
source organism |
Homo sapiens
|
ec nomenclature | |
pdb deposition date | 2021-02-03 |
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...