| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
|
+31 | 15-262 | 248 | 1-14, 263-379 | 14 | 117 | knot |
Chain Sequence |
HLFTSESVSEGHPDKIADQISDAVLDAILEQDPKARVACETYVKTGMVLVGGEITTSAWVDIEEITRNTVREIGYVHSDMGFDANSCAVLSAIGKQSPDINQGVDRADPLEQGAGDQGLMFGYATNETDVLMPAPITYAHRLVQRQAEVRKNGTLPWLRPDAKSQVTFQYDDGKIVGIDAVVLSTQHSEEIDQKSLQEAVMEEIIKPILPAEWLTSATKFFINPTGRFVIGGPMGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGLADRCEIQVSYAIGVAEPTSIMVETFGTEKVPSEQLTLLVREFFDLRPYGLIQMLDLLHPIYKETAAYGHFGREHFPWEKTDKAQLLRDAAG
|
Knotoid cutoff: 0.5


Knotoid matrix content: 1
| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
|
2.1 | 17-273 | 257 | 1-16 | 349-379 | 274-348 | 16 | 31 | slipknot | ||
| view details |
|
2.1 | 17-357 | 341 | 358-379 | 1-2 | 3-16 | 2 | 21 | slipknot | ||
| view details |
|
2.1 | 16-348 | 333 | 1-3, 358-379 | 4-15, 349-357 | 3 | 22 | slipknot |
| sequence length |
379
|
| structure length |
379
|
| publication title |
Protein and substrate flexibility contribute to enzymatic specificity in human and bacterial methionine adenosyltransferase
rcsb |
| molecule tags |
Transferase
|
| molecule keywords |
S-adenosylmethionine synthase
|
| source organism |
Escherichia coli 908573
|
| total genus |
Genus: 140
|
| ec nomenclature |
ec
2.5.1.6: Methionine adenosyltransferase. |
| pdb deposition date | 2021-02-10 |
| KnotProt deposition date | 2021-12-10 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF00438 | S-AdoMet_synt_N | S-adenosylmethionine synthetase, N-terminal domain |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...