Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
---|---|---|---|---|---|---|---|---|---|---|---|---|
view details |
![]() |
+31 | 91-135 | 45 | 1-90, 136-245 | 90 | 110 | knot |
Chain Sequence |
HVFFAVITLFPEMFDAITAYGISGRAAKRDIVQVTCINPRDFAEGNYRRVDERPFGGGPGMVMMAEPLAKAINHAKQLASRAGCVHVPVVYMSPQGKTLNEQAVQQFVDYDGLIVLCGRYEGVDERLIQHYVDQEWSIGDYVLSGGELPAMVLLDSIIRRLPNV------AIQDSFVDGLLDCPQYTKPDQFEGLDVPEILKSGHHANIEKWRFLQRYQRTLERRPELIEQVTLTKQQKKWLSDE
|
Knotoid cutoff: 0.5
Knotoid matrix content: 1
Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
---|---|---|---|---|---|---|---|---|---|---|---|---|
view details |
![]() |
3.1 | 90-152 | 63 | 1-89, 153-245 | 89 | 93 | knot | ||||
view details |
![]() |
2.1 | 90-136 | 47 | 1-89 | 153-245 | 137-152 | 89 | 93 | slipknot |
sequence length |
245
|
structure length |
239
|
publication title |
Crystal structure of a tRNA (guanine-N1)-methyltransferase from Acinetobacter baumannii AB5075-UW bound to S-adenosyl homocysteine
rcsb |
molecule tags |
Transferase
|
molecule keywords |
tRNA (guanine-N(1)-)-methyltransferase
|
source organism |
Acinetobacter baumannii
|
missing residues |
165-170
|
total genus |
![]() |
ec nomenclature |
ec
2.1.1.228: tRNA (guanine(37)-N(1))-methyltransferase. |
pdb deposition date | 2021-05-21 |
KnotProt deposition date | 2021-06-21 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF01746 | tRNA_m1G_MT | tRNA (Guanine-1)-methyltransferase |
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...