| Loop | Piercing | ||||
|---|---|---|---|---|---|
| view details | 2-c-13-b-25-c-23 | 19-b-31 |
Chain Sequence |
GCQSNHILKHNRCKQDSDCLAGCVCGPNGFCG
|
| sequence length |
32
|
| structure length |
32
|
| publication title |
Directed evolution identifies high-affinity cystine-knot peptide agonists and antagonists of Wnt/ beta-catenin signaling.
pubmed doi rcsb |
| molecule tags |
Signaling protein
|
| molecule keywords |
Low-density lipoprotein receptor-related protein 6
|
| source organism |
Homo sapiens
|
| ec nomenclature | |
| pdb deposition date | 2021-06-21 |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
