| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
+31 | 18-262 | 245 | 1-17, 263-384 | 17 | 122 | knot |
Chain Sequence |
AKHLFTSESVSEGHPDKIADQISDAVLDAILEQDPKARVACETYVKTGMVLVGGEITTSAWVDIEEITRNTVREIGYVHSDMGFDANSCAVLSAIGKQSPDINQGVDRADPLEQGAGDQGLMFGYATNETDVLMPAPITYAHRLVQRQAEVRKNGTLPWLRPDAKSQVTFQYDDGKIVGIDAVVLSTQHSEEIDQKSLQEAVMEEIIKPILPAEWLTSATKFFINPTGRFVIGGPMGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGLADRCEIQVSYAIGVAEPTSIMVETFGTEKVPSEQLTLLVREFFDLRPYGLIQMLDLLHPIYKETAAYGHFGREHFPWEKTDKAQLLRDAAGLKH
|
Knotoid cutoff: 0.5
Knotoid matrix content: 1
| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
2.1 | 18-355 | 338 | 1-17, 356-384 | 17 | 29 | knot | ||||
| view details |
|
2.1 | 18-271 | 254 | 1-17 | 351-384 | 272-350 | 17 | 34 | slipknot | ||
| view details |
 |
1.1 | 18-241 | 224 | 1-6, 253-384 | 7-17, 242-252 | 6 | 132 | slipknot |
| sequence length |
384
|
| structure length |
384
|
| publication title |
SAM hydrolase of bacteriophage T3 inactivates E. coli methionine S-adenosyltransferase by forming hetero-polymers
rcsb |
| molecule tags |
Hydrolase
|
| molecule keywords |
S-adenosylmethionine synthase
|
| source organism |
Escherichia coli (strain k12)
|
| total genus |
 Genus: 105
|
| ec nomenclature | |
| pdb deposition date | 2021-04-27 |
| KnotProt deposition date | 2021-07-28 |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
