| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
|
+31 | 24-256 | 233 | 1-23, 257-258 | 23 | 2 | knot |
Chain Sequence |
PDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF
|
| sequence length |
258
|
| structure length |
258
|
| publication title |
Human Carbonic Anhydrase I in complex with clorsulon
rcsb |
| molecule tags |
Lyase
|
| molecule keywords |
Carbonic anhydrase 1
|
| source organism |
Homo sapiens
|
| ec nomenclature | |
| pdb deposition date | 2021-08-31 |
| KnotProt deposition date | 2022-09-14 |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...