7SOHA

Exploring cystine dense peptide space to open a unique molecular toolbox
Cysteine knot
Loop Piercing
view details
2-c-5-b-28-c-19 16-b-33
Chain Sequence
GSMCMPCFTTDHQMARRCDDCCGGRGRGRCYGPQCLCR
sequence length 38
structure length 38
publication title Screening, large-scale production and structure-based classification of cystine-dense peptides.
doi rcsb
molecule tags Toxin
molecule keywords Chlorotoxin
source organism Leiurus quinquestriatus quinquestriatus
ec nomenclature
pdb deposition date 2021-10-30
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling