| Loop | Piercing | ||||
|---|---|---|---|---|---|
| view details | 28-c-32-b-84-c-82 | 10-b-60 |
Chain Sequence |
CPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS
|
| sequence length |
86
|
| structure length |
86
|
| publication title |
Autoantibody mimicry of hormone action at the thyrotropin receptor.
pubmed doi rcsb |
| molecule tags |
Membrane protein
|
| molecule keywords |
Glycoprotein hormones alpha chain
|
| source organism |
Lama glama
|
| ec nomenclature | |
| pdb deposition date | 2021-12-19 |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
