Loop | Piercing | ||||
---|---|---|---|---|---|
view details | 28-c-32-b-84-c-82 | 10-b-60 |
Chain Sequence |
CPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS
|
sequence length |
86
|
structure length |
86
|
publication title |
Autoantibody mimicry of hormone action at the thyrotropin receptor.
pubmed doi rcsb |
molecule tags |
Membrane protein
|
molecule keywords |
Glycoprotein hormones alpha chain
|
source organism |
Lama glama
|
ec nomenclature | |
pdb deposition date | 2021-12-19 |
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...