7U5OA

Crystal structure of the bone morphogenetic protein receptor type 2 ligand binding domain in complex with activin-b
Cysteine knot
Loop Piercing
view details
332-c-336-b-406-c-404 303-b-372
Chain Sequence
GLECDGRTNLCCRQQFFIDFRLIGWNDWIIAPTGYYGNYCEGSCPAYP----GSASSFHTAVVNQYRMRGLNPGTVNSCCIPTKLSTMSMLYFDDEYNIVKRDVPNMIVEECGCA
sequence length 115
structure length 111
publication title Type II BMP and activin receptors BMPR2 and ACVR2A share a conserved mode of growth factor recognition.
pubmed doi rcsb
molecule tags Signaling protein
molecule keywords Inhibin beta B chain
source organism Homo sapiens
missing residues 48-51
ec nomenclature
pdb deposition date 2022-03-02
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling