7U5PB

Crystal structure of the activin receptor type-2a ligand binding domain in complex with activin-a
Cysteine knot
Loop Piercing
view details
350-c-354-b-425-c-423 321-b-391
Chain Sequence
GLECDGKVNICCKKQFFVSFKDIGWNDWIIAPSGYHANYCEGECPST----SGSSLSFHSTVINHYRMRGHSPFANLKSCCVPTKLRPMSMLYYDDGQNIIKKDIQNMIVEECGCS
sequence length 116
structure length 112
publication title Type II BMP and activin receptors BMPR2 and ACVR2A share a conserved mode of growth factor recognition.
pubmed doi rcsb
molecule tags Signaling protein
molecule keywords Activin receptor type-2A
source organism Homo sapiens
missing residues 47-50
ec nomenclature
pdb deposition date 2022-03-02
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling