| Loop | Piercing | ||||
|---|---|---|---|---|---|
| view details | 350-c-354-b-425-c-423 | 321-b-391 |
Chain Sequence |
GLECDGKVNICCKKQFFVSFKDIGWNDWIIAPSGYHANYCEGECPST----SGSSLSFHSTVINHYRMRGHSPFANLKSCCVPTKLRPMSMLYYDDGQNIIKKDIQNMIVEECGCS
|
| sequence length |
116
|
| structure length |
112
|
| publication title |
Type II BMP and activin receptors BMPR2 and ACVR2A share a conserved mode of growth factor recognition.
pubmed doi rcsb |
| molecule tags |
Signaling protein
|
| molecule keywords |
Activin receptor type-2A
|
| source organism |
Homo sapiens
|
| missing residues |
47-50
|
| ec nomenclature | |
| pdb deposition date | 2022-03-02 |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
