7UTZA

Human thyrotropin analog tr1402 bound to human thyrotropin receptor in complex with minigs399 (composite structure)
Cysteine knot
Loop Piercing
view details
28-c-32-b-84-c-82 10-b-60
Chain Sequence
CPECTLRRNRFFSRPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS
sequence length 86
structure length 86
publication title Autoantibody mimicry of hormone action at the thyrotropin receptor.
pubmed doi rcsb
molecule tags Membrane protein
molecule keywords Glycoprotein hormones alpha chain analog TR1402
source organism Homo sapiens
ec nomenclature
pdb deposition date 2022-04-28
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling
Application loaded.