8BWBA

Spider toxin pha1b (pntx3-6) from phoneutria nigriventer targeting cav2.x calcium channels and trpa1 channel
Cysteine knot
Loop Piercing
view details
2-c-9-b-22-c-16 15-b-37
Chain Sequence
ACIPRGEICTDDCECCGCDNQCYCPPGSSLGIFKCSCAHANKYFCNRKKEKCKKA
sequence length 55
structure length 55
publication title Recombinant Production, NMR Solution Structure, and Membrane Interaction of the Ph alpha 1 beta Toxin, a TRPA1 Modulator from the Brazilian Armed Spider Phoneutria nigriventer
doi rcsb
molecule tags Toxin
molecule keywords Omega-ctenitoxin-Pn4a
source organism Phoneutria nigriventer
ec nomenclature
pdb deposition date 2022-12-06
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling