8F5XA

Crystal structure of human eosinophil-derived neurotoxin (edn, ribonuclease 2) in complex with 5'-adenosine monophosphate (amp)
Cysteine knot
Loop Piercing
view details
37-c-55-b-111-c-96 23-b-83
Chain Sequence
MKPPQFTWAQWFETQHINMTSQQCTNAMQVINNYQRRCKNQNTFLLTTFANVVNVCGNPNMTCPSNKTRKNCHHSGSQVPLIHCNLTTPSPQNISNCRYAQTPANMFYIVACDNRDQRRDPPQYPVVPVHLDRII
sequence length 135
structure length 135
publication title Crystal structure of human eosinophil-derived neurotoxin (EDN, ribonuclease 2) in complex with 5'-adenosine monophosphate (AMP)
rcsb
molecule tags Hydrolase
molecule keywords Non-secretory ribonuclease
source organism Homo sapiens
ec nomenclature ec 4.6.1.18: pancreatic ribonuclease.
pdb deposition date 2022-11-15
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling