| Loop | Piercing | ||||
|---|---|---|---|---|---|
| view details | 2-c-9-b-22-c-16 | 9-b-32 |
Chain Sequence |
GCKGQDAPCSKSKDCCGEASMCSKGADGKKTCMIDKLWG
|
| sequence length |
39
|
| structure length |
39
|
| publication title |
Structural and functional characterisation of Tst2, a novel TRPV1 inhibitory peptide from the Australian sea anemone Telmatactis stephensoni.
pubmed doi rcsb |
| molecule tags |
Toxin
|
| molecule keywords |
TRPV1 inhibitory peptide Tst2
|
| source organism |
Telmatactis stephensoni
|
| ec nomenclature | |
| pdb deposition date | 2023-04-10 |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
