2EFV | KnotProt

					Knot core range	Knot core length	Knot tails range	Slipknot tails range	Slipknot loops range	N-end length	C-end length	Type
view details				-3₁	6-77	72	1-5, 78-82			5	5	knot

FMKEKKRATFYLYKNIDGRKLRYLLHKLENVENVDIDTLRRAIEAEKKYKRSITLTEEEEVIIQRLGKSANLLLNCELVKLD

Warning

Chain breaks within knotoid 5₂ (displayed as a gray area on the plot and as '-' on the sequence). The broken part of the chain has been replaced by a straight segment, which may affect what knot types are detected - be careful with interpreting results.
Chain breaks within knotoid 3₁ (displayed as a gray area on the plot and as '-' on the sequence). The broken part of the chain has been replaced by a straight segment, which may affect what knot types are detected - be careful with interpreting results.

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling