Slipknot
Knot core rangeKnot core lengthKnot tails rangeSlipknot tails rangeSlipknot loops rangeN-end lengthC-end lengthType
view details
-52 12-225 214 1-11, 226-229 11 4 knot
view details
-31 12-166 155 1-11 224-229 167-223 11 6 slipknot
Chain Sequence
PLGSMAEGNWCLIESDPGIFTEMIHGFGCTGLQVEELVVLDESIEHLKPIHGFIFLFRWLKKEMRKEVDDSPQTCTDVYFSQQVIQNACASQALINLLLNCDHPDVDLGPTLKEFKDFTYDLDSASRGLCLTNSEKIRAVHNSFG----------QKLDEEDVFHFVTYVPVNDGVYELDGLRAAPLRLGTVASDGDWTEVAIKAIKEKIKNYGESEVRFNLMAVISDQ
Warning
  • Chain breaks within knot 52 (displayed as a gray area on the plot and as '-' on the sequence). The broken part of the chain has been replaced by a straight segment, which may affect what knot types are detected - be careful with interpreting results.
  • Chain breaks within knot 31 (displayed as a gray area on the plot and as '-' on the sequence). The broken part of the chain has been replaced by a straight segment, which may affect what knot types are detected - be careful with interpreting results.

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling
Application loaded.