Slipknot
Knot core rangeKnot core lengthKnot tails rangeSlipknot tails rangeSlipknot loops rangeN-end lengthC-end lengthType
view details
-52 5-218 214 1-4, 219-315 4 97 knot
view details
-31 5-161 157 1-4 215-315 162-214 4 101 slipknot
Chain Sequence
GEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGEEPAGSVVQDSRLDTIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEFSQSFDAAMKGLALSNSDVIRQVHNSFARQQMFEFDT------EDAFHFVSYVPVNGRLYELDGLREGPIDLGACNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQKIAELQRQLAEENSMLSA-------IQSEVAKNQMLIEEEVQKLKRYKIENIRRKHNYLPFIMELLKTLAEHQQLIPLVEKAKEKQN
Warning
  • Chain breaks within knot 52 (displayed as a gray area on the plot and as '-' on the sequence). The broken part of the chain has been replaced by a straight segment, which may affect what knot types are detected - be careful with interpreting results.
  • Chain breaks within knot 31 (displayed as a gray area on the plot and as '-' on the sequence). The broken part of the chain has been replaced by a straight segment, which may affect what knot types are detected - be careful with interpreting results.

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling
Application loaded.